PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.3G067200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GRAS
Protein Properties Length: 630aa    MW: 71519 Da    PI: 5.9126
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.3G067200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS366.63.4e-1122506211374
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                         l+ lL++cAea++s+++   ++lL+++++++sp+gd  +Rla yf+ AL+ar+a+++s++y++l +++ts   +++ l+a++lf  ++P+ 
  Sevir.3G067200.1.p 250 LRALLIQCAEAIASNNQPFDRELLTKIRDHSSPYGDDSHRLAIYFVDALEARIAGTGSQMYQKLMARRTS---TTDMLKAYRLFTAACPFT 337
                         5789************************************************************999999...89**************** PP

                GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnv 180
                         k+++   Nq+I++   +  rvHiiDf+i  G+QWp+L+q +a+R++gpp+lRiTg++ pe+g    +++eetg+rLa++Ae ++vpf+++ 
  Sevir.3G067200.1.p 338 KVAYYYSNQTIVDVSVERPRVHIIDFGIVFGFQWPSLIQRFANRQGGPPNLRITGIDVPEPGfrPCKKIEETGKRLAEYAEMFNVPFQYQC 428
                         *************************************************************99999************************* PP

                GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl 271
                          va+r+e++ +++L+++++E+l++n+ +ql +l de+ +++s+rd+vL+++ +++P+v+++   +  +ns+ Fl rf eal yys+ fd+l
  Sevir.3G067200.1.p 429 -VASRWENICIKDLNIDKDEVLIINCLHQLNNLSDETEDIDSARDRVLRIMMRMNPEVLIIGVTNGLYNSPFFLPRFREALFYYSSQFDML 518
                         .7***************************************************************************************** PP

                GRAS 272 eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgW 362
                         ++++ r +e+ri +Er llg ++ nvvacegaer+e+ et+++W+ r+ +aGFk++p+++++ k+  +  +  + + + v+e+sg+l++gW
  Sevir.3G067200.1.p 519 NSTVIRSHEARILIERDLLGADLFNVVACEGAERIEKPETYKQWQVRILKAGFKQLPVNQTILKSSVARKKDLYHEDFVVDEDSGWLLQGW 609
                         ******************************************************************99999999899************** PP

                GRAS 363 kdrpLvsvSaWr 374
                         k+r L ++S+W+
  Sevir.3G067200.1.p 610 KGRILHALSSWK 621
                         ***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.711224601IPR005202Transcription factor GRAS
PfamPF035141.2E-109250621IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 630 aa     Download sequence    Send to blast
MDSSEYCEIN SNMTLEYINR ILLEEDIDEK PSIYQERDAL QATEKPFYDI LGQVYPSPAK  60
EIVLNSDSQG PDDISNNYHE GACSGSLDND FLGAQGMHLI PNDYGSETDH LSLQFTKGAE  120
EANKFVPIVE KLVVDLGSSE LAVSKQMTQA TVGQKGNHVN KIRSHPHVNL ELLNTKNSKH  180
LAISGSETIR DETFDSVLLC TGQLSRDAAH LREMKAKEAR DSSQIAQSKE YGKGKVKSRA  240
RKQQEEAIDL RALLIQCAEA IASNNQPFDR ELLTKIRDHS SPYGDDSHRL AIYFVDALEA  300
RIAGTGSQMY QKLMARRTST TDMLKAYRLF TAACPFTKVA YYYSNQTIVD VSVERPRVHI  360
IDFGIVFGFQ WPSLIQRFAN RQGGPPNLRI TGIDVPEPGF RPCKKIEETG KRLAEYAEMF  420
NVPFQYQCVA SRWENICIKD LNIDKDEVLI INCLHQLNNL SDETEDIDSA RDRVLRIMMR  480
MNPEVLIIGV TNGLYNSPFF LPRFREALFY YSSQFDMLNS TVIRSHEARI LIERDLLGAD  540
LFNVVACEGA ERIEKPETYK QWQVRILKAG FKQLPVNQTI LKSSVARKKD LYHEDFVVDE  600
DSGWLLQGWK GRILHALSSW KPKESYTNQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-492546218375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004963450.10.0PREDICTED: uncharacterized protein LOC101786830
TrEMBLK3ZDA50.0K3ZDA5_SETIT; Uncharacterized protein
STRINGSi024539m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP150538118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-165GRAS family protein